Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Buffalo Chicken Quesadilla

Shredded rotisserie chicken tossed with buffalo sauce, melted between tortillas with cheddar, then pan-fried until the outside crisps and the cheese oozes. Serve with mayo for dipping and pickled vegetables on the side.

Total time
12 min
Servings
2
Calories
520
Protein
34g
Crispy Buffalo Chicken Quesadilla
comfortquickmexicanchickencrispymeltytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss shredded chicken with buffalo sauce until fully coated.

  2. Step 2

    Lay one tortilla flat, sprinkle half the cheese on it, then top with buffalo chicken.

  3. Step 3

    Add remaining cheese, then place second tortilla on top and press gently.

  4. Step 4

    Heat a skillet over medium-high until a water droplet sizzles on contact, ~60 seconds.

  5. Step 5

    Slide quesadilla into the skillet and cook 3 minutes until golden and crispy on the bottom.

  6. Step 6

    Flip carefully and cook 2 minutes more until the second side is golden and cheese melts through.

Tools you’ll need

  • medium bowl
  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.