Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken with Garlic Fish Sauce

Fried chicken thighs glazed in a punchy garlic-fish sauce reduction with crispy edges and tender meat. Serve over rice with scallions and lime — the TikTok version of cơm gà chiên.

Total time
28 min
Servings
2
Calories
385
Protein
38g
Crispy Chicken with Garlic Fish Sauce
comfortcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry and season generously with salt and black pepper on both sides.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until shimmering. Place chicken skin-side down and sear without moving for 6 minutes until skin is golden and crispy.

  3. Step 3

    Flip chicken and sear the other side for 4 minutes until cooked through. Transfer to a plate.

  4. Step 4

    Pour off excess fat, leaving 1 tbsp. Add garlic and cook 30 seconds until fragrant, then add fish sauce, sugar, and broth.

  5. Step 5

    Return chicken to the skillet and turn to coat in glaze. Simmer for 2 minutes until sauce thickens and clings to the chicken.

  6. Step 6

    Squeeze lime juice over the top and garnish with scallions. Serve immediately over rice.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • paper towels
  • measuring spoons
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.