Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Parm

Pounded thin chicken cutlets, breaded and pan-fried until golden, then smothered in marinara and melted mozzarella. Ready in 15 minutes and tastes like you spent way longer.

Total time
15 min
Servings
2
Calories
520
Protein
48g
Crispy Chicken Parm
comfortquickamericanchickencrispytendermeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place each chicken breast between plastic wrap and pound to 1/4-inch thick using a meat mallet or heavy pan.

  2. Step 2

    Set up three shallow bowls with flour, beaten egg, and panko mixed with a pinch of salt and pepper.

  3. Step 3

    Coat each chicken breast in flour, shaking off excess, then dip in egg, then press into panko until fully coated.

  4. Step 4

    Heat olive oil in a 12-inch skillet over medium-high heat. Once shimmering, slide in the breaded chicken.

  5. Step 5

    Fry 3 minutes per side until golden brown and cooked through. Transfer to a plate.

  6. Step 6

    Return chicken to the skillet, pour marinara over each piece, scatter mozzarella on top, cover, and cook until cheese melts, about 2 minutes.

Tools you’ll need

  • meat mallet or heavy pan
  • three shallow bowls
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.