Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Melty Gochujang Fire Chicken

Spicy gochujang-glazed chicken thighs finished with melted mozzarella—crispy edges, gooey cheese, pure heat. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Melty Gochujang Fire Chicken
comfortindulgentkoreanchickencrispytendermeltyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season with salt and pepper on both sides.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Place chicken skin-side down in the pan. Sear 6 minutes without moving until edges brown.

  4. Step 4

    Flip chicken. Mix gochujang, honey, and soy sauce in a bowl, then brush generously over the meat.

  5. Step 5

    Cook 5 minutes, then scatter mozzarella evenly over the chicken. Cover and cook until cheese melts, ~3 minutes.

  6. Step 6

    Slide onto a plate. Sprinkle with scallions and sesame seeds. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • small bowl
  • spoon for mixing
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.