Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Schnitzel with Roasted Potatoes & Salad

Golden-fried thin chicken cutlets with herb-seasoned roasted potatoes and fresh green salad. Restaurant-quality schnitzel that comes together in under 30 minutes.

Total time
28 min
Servings
2
Calories
640
Protein
48g
Crispy Chicken Schnitzel with Roasted Potatoes & Salad
satisfyingsimpleisraelichickencrispytenderjuicySalad

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place potatoes on a sheet pan, drizzle with 2 tbsp oil, salt, and pepper. Roast at 425°F for 20 minutes until golden and tender.

  2. Step 2

    Pound chicken breasts between plastic wrap until 1/4-inch thick. Season both sides generously with salt and pepper.

  3. Step 3

    Set up three shallow bowls: flour in the first, beaten eggs in the second, panko mixed with 1 tsp dried oregano in the third.

  4. Step 4

    Coat each chicken piece in flour, shake off excess, dip in egg, then coat fully with panko, pressing gently so it adheres.

  5. Step 5

    Heat 3 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds. Fry chicken 3–4 minutes per side until golden brown and cooked through.

  6. Step 6

    Toss greens with juice of 1 lemon, 1 tbsp oil, salt, and pepper. Plate schnitzel, potatoes, salad, and lemon wedges.

Tools you’ll need

  • sheet pan
  • large skillet (12-inch)
  • plastic wrap
  • meat mallet
  • three shallow bowls
  • tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.