Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chili Avocado Toast

Ripe avocado smashed on sourdough with chili crisp, everything seasoning, and a crack of fleur de sel. Ready in 5 minutes—pure TikTok gold.

Total time
5 min
Servings
2
Calories
310
Protein
9g
Crispy Chili Avocado Toast
freshquickcalifornianvegetarianvegancreamycrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast the sourdough until the edges turn golden and the surface is crispy, 2–3 minutes.

  2. Step 2

    Halve the avocado, scoop the flesh into a bowl, and mash with a fork until chunky.

  3. Step 3

    Squeeze the lemon half into the mash and stir gently. Season with a pinch of salt and pepper.

  4. Step 4

    Spread the avocado evenly across both toasted slices.

  5. Step 5

    Drizzle 1 tbsp chili crisp over each slice, then sprinkle with everything bagel seasoning.

  6. Step 6

    Finish with a tiny pinch of fleur de sel. Serve immediately.

Tools you’ll need

  • toaster
  • small bowl
  • fork
  • butter knife or offset spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.