Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Crisp Avocado Toast

Creamy smashed avocado on crispy toast, topped with everything bagel seasoning and a drizzle of chili crisp. Ready in 5 minutes, zero cooking required beyond toasting bread.

Total time
5 min
Servings
2
Calories
248
Protein
6g
Chili Crisp Avocado Toast
casualquickcalifornianvegetarianvegancrispycreamyweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast bread until golden and crispy, about 2 minutes.

  2. Step 2

    Halve the avocado, scoop flesh into a bowl, and mash with a fork until chunky-creamy.

  3. Step 3

    Squeeze lemon juice over the mashed avocado and pinch of salt; stir gently.

  4. Step 4

    Divide mashed avocado between the two toasts and spread to the edges.

  5. Step 5

    Sprinkle everything seasoning evenly over both toasts.

  6. Step 6

    Drizzle chili crisp oil over the top and serve immediately.

Tools you’ll need

  • toaster
  • small bowl
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.