CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cinnamon Sugar Twists

Puff pastry twisted, buttered, and baked until golden with cinnamon sugar coating. Ready in 20 minutes with zero fuss.

Total time
20 min
Servings
8
Calories
185
Protein
2g
Crispy Cinnamon Sugar Twists
simplequickamericanvegetariancrispyflakyweeknightsnack

Ingredients

  • 1 sheet (about 10 oz) puff pastry, thawed
  • 3 tbsp butter, melted
  • 1.5 tsp cinnamon
  • 3 tbsp sugar

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Mix cinnamon and sugar in a small bowl until well combined.

  3. 3

    Brush puff pastry sheet with melted butter on both sides.

  4. 4

    Sprinkle cinnamon sugar mixture evenly over the buttered pastry.

  5. 5

    Cut pastry into 1-inch strips, then twist each strip 3–4 times and lay flat on the pan.

  6. 6

    Bake for 10–12 minutes until golden brown and edges are crispy. Cool 2 minutes before serving.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush
  • knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.