Crispy Cinnamon Sugar Twists
Puff pastry twisted, buttered, and baked until golden with cinnamon sugar coating. Ready in 20 minutes with zero fuss.
- Total time
- 20 min
- Servings
- 8
- Calories
- 185
- Protein
- 2g

simplequickamericanvegetariancrispyflakyweeknightsnack
Ingredients
- 1 sheet (about 10 oz) puff pastry, thawed
- 3 tbsp butter, melted
- 1.5 tsp cinnamon
- 3 tbsp sugar
Instructions
- 1
Preheat oven to 400°F. Line a sheet pan with parchment paper.
- 2
Mix cinnamon and sugar in a small bowl until well combined.
- 3
Brush puff pastry sheet with melted butter on both sides.
- 4
Sprinkle cinnamon sugar mixture evenly over the buttered pastry.
- 5
Cut pastry into 1-inch strips, then twist each strip 3–4 times and lay flat on the pan.
- 6
Bake for 10–12 minutes until golden brown and edges are crispy. Cool 2 minutes before serving.
Tools you’ll need
- sheet pan
- parchment paper
- small bowl
- pastry brush
- knife
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



