Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Dan Bing (Scallion Pancake)

Flaky Taiwanese egg crepe with crispy scallions and a savory-sweet glaze. Pan-fried in under 5 minutes for a viral TikTok breakfast or dinner.

Total time
15 min
Servings
2
Calories
385
Protein
9g
15-Min Crispy Dan Bing (Scallion Pancake)
simplequickindulgenttaiwanesevegetarianeggscrispyflaky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 cup water, salt, and 1 tbsp oil into a rough dough; let rest 2 minutes.

  2. Step 2

    Knead dough 30 seconds until smooth, then press flat on a sheet of plastic wrap into a thin 8-inch round.

  3. Step 3

    Heat 1 tbsp oil in a nonstick skillet over medium-high until shimmering, ~60 seconds.

  4. Step 4

    Slide dough into skillet. Crack 1 egg onto the center, scatter half the scallions over top, press gently.

  5. Step 5

    Cook 2 minutes until bottom edges crisp and curl slightly, then flip and cook 90 seconds more.

  6. Step 6

    Mix soy sauce, sesame oil, and sugar; drizzle over pancake. Slide onto a plate, top with remaining scallions, serve immediately.

Tools you’ll need

  • 10-inch nonstick skillet
  • mixing bowl
  • plastic wrap
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.