Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Dan Bing (Taiwanese Egg Crepe)

Thin, crispy crepes stuffed with scrambled eggs, scallions, and a sweet-savory sauce. Ready in 20 minutes and impossibly addictive.

Total time
20 min
Servings
2
Calories
410
Protein
14g
Crispy Dan Bing (Taiwanese Egg Crepe)
quickcasualtaiwanesevegetarianeggscrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour and water until smooth. Let rest 5 minutes while you prep.

  2. Step 2

    Heat a nonstick or well-seasoned skillet over medium-high until a drop of water sizzles.

  3. Step 3

    Pour 1/4 cup batter in the center, then tilt and swirl the pan to spread into a thin crepe.

  4. Step 4

    Cook until the bottom is golden and edges lift, about 1 minute, then flip.

  5. Step 5

    Crack one egg onto the crepe, scramble it with a spatula, then scatter scallions over top.

  6. Step 6

    Fold crepe in half. Drizzle with a mixture of hoisin, soy sauce, and sesame oil. Serve hot.

Tools you’ll need

  • medium bowl
  • whisk
  • 12-inch nonstick skillet or well-seasoned cast iron
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.