Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Dutch Kibbeling in 20 Minutes

Bite-sized whitefish chunks fried golden-crisp in a light beer batter, served with tartar sauce and lemon. Pure Dutch street food nostalgia, ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Crispy Dutch Kibbeling in 20 Minutes
casualsatisfyingdutchfishcrispytenderweeknightcasual

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish chunks dry with paper towels. Season generously with salt and pepper.

  2. Step 2

    Whisk flour, beer, 0.25 tsp salt, and 0.25 tsp pepper until smooth and thick like pancake batter.

  3. Step 3

    Heat oil in a heavy pot or deep skillet to 350°F (use a thermometer). Oil should shimmer and shimmer at the surface.

  4. Step 4

    Working in batches, dip fish chunks into batter to coat fully, then slide into hot oil. Fry 2–3 minutes until golden-brown and crispy.

  5. Step 5

    Remove with a slotted spoon and drain on paper towels. Keep warm while frying remaining batches.

  6. Step 6

    Serve hot with tartar sauce and lemon wedges on the side.

Tools you’ll need

  • heavy pot or deep skillet (3–4 quart)
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • whisk
  • shallow bowl for batter

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.