Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Eggplant & Spiced Chickpea Bowls

Roasted eggplant halves stuffed with warm, spiced chickpeas, topped with tahini drizzle and fresh herbs. Sheet-pan Middle Eastern comfort that tastes restaurant-quality in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
10g
Crispy Eggplant & Spiced Chickpea Bowls
comfortwholesomemiddle-easternvegetarianveganchickpeascreamytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the eggplant lengthwise. Score the flesh in a crosshatch pattern, then brush all sides with oil and salt.

  2. Step 2

    Roast eggplant cut-side down on a sheet pan at 425°F until flesh is tender and golden, about 12 minutes.

  3. Step 3

    While eggplant roasts, toss chickpeas with cumin, coriander, 1 tbsp oil, salt, and pepper until coated and fragrant.

  4. Step 4

    Flip eggplant halves cut-side up. Mound chickpea mixture into each cavity, pressing gently to pack.

  5. Step 5

    Roast 3 more minutes until chickpeas warm through and eggplant edges darken slightly.

  6. Step 6

    Drizzle tahini mixed with lemon juice over each half. Scatter fresh herbs and a pinch of salt on top. Serve hot.

Tools you’ll need

  • sheet pan
  • knife
  • brush
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.