Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Roasted Chickpea Buddha Bowl

Crispy roasted chickpeas, fluffy quinoa, and roasted sweet potato tossed with a bright tahini-lemon dressing. Builds a satisfying, protein-packed bowl in under 25 minutes.

Total time
25 min
Servings
2
Calories
580
Protein
18g
Roasted Chickpea Buddha Bowl
healthywholesomemediterraneanvegetarianveganchickpeascrispyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Toss chickpeas and sweet potato with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Roast for 18–20 minutes, shaking halfway, until sweet potato is tender and chickpeas are crispy.

  3. Step 3

    While vegetables roast, boil quinoa in salted water for 12–14 minutes until fluffy and liquid is absorbed.

  4. Step 4

    Whisk tahini, lemon juice, garlic, 3 tbsp water, salt, and pepper until smooth and pourable.

  5. Step 5

    Divide quinoa between two bowls. Top with roasted chickpeas and sweet potato.

  6. Step 6

    Drizzle tahini dressing over the top. Serve immediately.

Tools you’ll need

  • sheet pan
  • large pot with lid
  • small bowl
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.