Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Farro & Roasted Veg Bowl

Nutty farro paired with charred zucchini, bell peppers, and cherry tomatoes, finished with a bright lemon-garlic drizzle. One-pan roast, then toss together for a weeknight Italian dinner that feels restaurant-quality.

Total time
28 min
Servings
2
Calories
485
Protein
15g
Crispy Farro & Roasted Veg Bowl
freshwholesomeitalianvegetarianvegetariancrispytenderchewy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil farro in salted water until tender and chewy, about 20 minutes. Drain and set aside.

  2. Step 2

    While farro cooks, toss zucchini, bell pepper, and cherry tomatoes with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  3. Step 3

    Roast at 425°F until vegetables are charred and tender, stirring halfway through, about 15 minutes.

  4. Step 4

    Whisk together lemon juice, lemon zest, minced garlic, oregano, and red pepper flakes with 2 tbsp olive oil.

  5. Step 5

    Toss warm farro with roasted vegetables, then drizzle with lemon-garlic dressing and toss to coat.

  6. Step 6

    Divide between bowls and serve warm or at room temperature.

Tools you’ll need

  • large pot
  • sheet pan
  • small mixing bowl
  • wooden spoon
  • serving spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.