CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Farro & Roasted Vegetable Bowl

Nutty farro pairs with caramelized roasted vegetables and a bright lemon-olive oil drizzle for a hearty, satisfying dinner. Ready in under 30 minutes with minimal cleanup.

Total time
28 min
Servings
2
Calories
385
Protein
13g
Crispy Farro & Roasted Vegetable Bowl
wholesomesatisfyingitalianvegetarianveganvegetariancrispytender

Ingredients

  • 1 cup farro
  • 10 oz cherry tomatoes
  • 1 medium zucchini
  • 1 large bell pepper (red or yellow)
  • ½ medium red onion
  • 1 whole lemon
  • ¼ cup, chopped fresh basil or parsley

Instructions

  1. 1

    Bring 2.5 cups salted water to boil in a pot. Add farro and simmer 20 minutes until tender but chewy.

  2. 2

    While farro cooks, halve tomatoes and chop zucchini, bell pepper, and red onion into 1-inch pieces.

  3. 3

    Toss vegetables with 2 tbsp olive oil, salt, and pepper on a sheet pan. Spread in a single layer.

  4. 4

    Roast vegetables at 425°F for 18–20 minutes until edges caramelize and char slightly.

  5. 5

    Drain farro and transfer to bowls. Top with roasted vegetables and scatter fresh basil over top.

  6. 6

    Drizzle with lemon juice and a final glug of olive oil. Season to taste with salt and pepper.

Tools you’ll need

  • medium pot with lid
  • sheet pan
  • cutting board
  • chef's knife
  • large bowl for tossing

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.