Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Farro & Roasted Vegetable Bowl

Nutty farro pairs with caramelized roasted vegetables and a bright lemon-olive oil drizzle for a hearty, satisfying dinner. Ready in under 30 minutes with minimal cleanup.

Total time
28 min
Servings
2
Calories
385
Protein
13g
Crispy Farro & Roasted Vegetable Bowl
wholesomesatisfyingitalianvegetarianveganvegetariancrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring 2.5 cups salted water to boil in a pot. Add farro and simmer 20 minutes until tender but chewy.

  2. Step 2

    While farro cooks, halve tomatoes and chop zucchini, bell pepper, and red onion into 1-inch pieces.

  3. Step 3

    Toss vegetables with 2 tbsp olive oil, salt, and pepper on a sheet pan. Spread in a single layer.

  4. Step 4

    Roast vegetables at 425°F for 18–20 minutes until edges caramelize and char slightly.

  5. Step 5

    Drain farro and transfer to bowls. Top with roasted vegetables and scatter fresh basil over top.

  6. Step 6

    Drizzle with lemon juice and a final glug of olive oil. Season to taste with salt and pepper.

Tools you’ll need

  • medium pot with lid
  • sheet pan
  • cutting board
  • chef's knife
  • large bowl for tossing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.