Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fish in Dill Sauce

Whole fish or thick fillets fried until golden, then finished in a tangy Vietnamese dill broth. Sweet, savory, and aromatic in under 20 minutes.

Total time
18 min
Servings
2
Calories
312
Protein
42g
Crispy Fish in Dill Sauce
simplefreshvietnamesefishcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry with paper towels. Season generously with salt and black pepper on both sides.

  2. Step 2

    Dredge fish in flour, shaking off excess. Heat 2 tbsp neutral oil in a 12-inch skillet over medium-high until shimmering.

  3. Step 3

    Slide fish into the skillet without moving for 3 minutes. Flip once and cook 2 minutes more until golden and cooked through.

  4. Step 4

    Transfer fish to a plate. In the same skillet, add water, fish sauce, and lime juice; bring to a simmer for 1 minute.

  5. Step 5

    Stir in dill until fragrant, about 30 seconds. Return fish to the skillet to coat in the sauce.

  6. Step 6

    Serve immediately in shallow bowls with broth spooned over the fish.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • shallow bowl
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.