CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Fish in Dill Sauce

Whole fish or thick fillets fried until golden, then finished in a tangy Vietnamese dill broth. Sweet, savory, and aromatic in under 20 minutes.

Total time
18 min
Servings
2
Calories
312
Protein
42g
Crispy Fish in Dill Sauce
simplefreshvietnamesefishcrispytenderweeknightmain-dish

Ingredients

  • 1 lb white fish fillets (sea bass, snapper, or grouper)
  • ½ cup fresh dill, chopped
  • 3 tbsp lime juice
  • 2 tbsp fish sauce
  • ½ cup all-purpose flour
  • 1 cup water

Instructions

  1. 1

    Pat fish dry with paper towels. Season generously with salt and black pepper on both sides.

  2. 2

    Dredge fish in flour, shaking off excess. Heat 2 tbsp neutral oil in a 12-inch skillet over medium-high until shimmering.

  3. 3

    Slide fish into the skillet without moving for 3 minutes. Flip once and cook 2 minutes more until golden and cooked through.

  4. 4

    Transfer fish to a plate. In the same skillet, add water, fish sauce, and lime juice; bring to a simmer for 1 minute.

  5. 5

    Stir in dill until fragrant, about 30 seconds. Return fish to the skillet to coat in the sauce.

  6. 6

    Serve immediately in shallow bowls with broth spooned over the fish.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • shallow bowl
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.