Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Garlic Chicken Banh Mi

Juicy pan-seared chicken with a punchy mayo-sriracha spread, pickled daikon, fresh veggies, and toasted baguette. Comes together in 20 minutes—pure vibes.

Total time
20 min
Servings
2
Calories
520
Protein
36g
Crispy Garlic Chicken Banh Mi
freshquicksatisfyingvietnamesechickencrispyjuicytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry. Season generously with salt and black pepper on both sides.

  2. Step 2

    Heat 1 tbsp oil in a skillet over medium-high until it shimmers. Sear chicken 6–7 minutes per side without moving until golden and cooked through (165°F).

  3. Step 3

    Slice baguette in half lengthwise. Toast cut-side down in the same skillet until golden, about 90 seconds per side.

  4. Step 4

    Stir mayo and sriracha together. Spread on both baguette halves.

  5. Step 5

    Slice chicken against the grain. Layer on bottom half: lettuce, chicken, pickled daikon, cucumber, chili, cilantro.

  6. Step 6

    Close the sandwich. Cut in half and serve immediately.

Tools you’ll need

  • 12-inch skillet or cast-iron pan
  • cutting board
  • sharp knife
  • meat thermometer (optional but recommended)
  • small bowl for mayo-sriracha mix

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.