Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Garlic Chicken & Rice — Cơm Gà Chiên

Vietnamese fried chicken with crispy garlic skin over jasmine rice and a bright lime squeeze. Ready in under 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Crispy Garlic Chicken & Rice — Cơm Gà Chiên
satisfyingcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry with paper towels. Season generously all over with salt and black pepper.

  2. Step 2

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Place chicken skin-side down in the pan without moving. Sear 8–9 minutes until skin is golden brown and crispy.

  4. Step 4

    Flip chicken and cook 6–7 minutes more until the internal temperature hits 165°F at the thickest part.

  5. Step 5

    Push chicken to the side. Add minced garlic to the empty space and stir constantly for 60 seconds until fragrant.

  6. Step 6

    Pour fish sauce over the chicken and toss gently to coat. Divide rice and chicken between plates, top with scallions and serve with lime wedges.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • paper towels
  • instant-read thermometer
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.