Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Grissini Torinesi

Snappy Italian breadsticks with a salty crust and tender crumb, ready in under 25 minutes. No yeast waiting—just olive oil, flour, and a hot oven.

Total time
22 min
Servings
4
Calories
285
Protein
7g
Crispy Grissini Torinesi
simplecasualitalianvegancrispytenderweeknightsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, salt, and warm water in a bowl until a shaggy dough forms, then knead for 2 minutes until smooth.

  2. Step 2

    Add olive oil to the dough and knead for 1 minute until fully incorporated and dough feels silky.

  3. Step 3

    Divide dough into 12 pieces. Roll each into a thin rope about 10 inches long.

  4. Step 4

    Place ropes on a parchment-lined sheet pan, brush lightly with olive oil, and sprinkle with coarse sea salt and sesame seeds.

  5. Step 5

    Bake at 425°F for 12–14 minutes until golden brown and crispy throughout.

  6. Step 6

    Cool on the sheet pan for 2 minutes, then serve.

Tools you’ll need

  • mixing bowl
  • sheet pan
  • parchment paper
  • oven
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.