Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Halloumi Popcorn with Fries & Dip

Cubed halloumi cheese fried until golden and squeaky, tossed hot with salt and served alongside crispy fries and your favorite dipping sauce. Pure indulgence in under 10 minutes.

Total time
10 min
Servings
2
Calories
380
Protein
20g
Crispy Halloumi Popcorn with Fries & Dip
indulgentcasualmediterraneanvegetariancheesecrispysqueakymelty

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut halloumi into 1/2-inch cubes and pat dry with paper towels.

  2. Step 2

    Cook frozen fries per package directions (oven or air fryer) until golden and hot.

  3. Step 3

    Heat oil in a skillet over medium-high until shimmering, about 1 minute.

  4. Step 4

    Add halloumi cubes in a single layer and cook without stirring for 90 seconds until golden.

  5. Step 5

    Toss halloumi and cook another 60-90 seconds until all sides are golden and cheese squeaks slightly.

  6. Step 6

    Transfer halloumi to a plate, season with salt and pepper, and serve immediately with hot fries and dipping sauce.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.