CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Ham & Cream Cheese Roll-Ups

Spread cream cheese on deli ham, wrap in tortilla, and crisp in a skillet until golden. Serve with fresh arugula for a quick, savory handheld that's ready in 10 minutes.

Total time
10 min
Servings
2
Calories
320
Protein
16g
Crispy Ham & Cream Cheese Roll-Ups
quicksimpleamericanporkcrispycreamyweeknightsandwich

Ingredients

  • 6 slices deli ham
  • 3 oz cream cheese
  • 2 large (8-inch) flour tortilla

Instructions

  1. 1

    Lay 3 ham slices overlapping on a cutting board, then spread 1.5 oz cream cheese across them.

  2. 2

    Roll up tightly from one end, then place seam-side down on a tortilla and roll the tortilla around it.

  3. 3

    Repeat with remaining ham, cream cheese, and tortilla to make a second roll-up.

  4. 4

    Heat oil in a skillet over medium-high heat until shimmering, about 90 seconds.

  5. 5

    Place roll-ups seam-side down in the skillet and cook 2 minutes until golden, then flip and cook 1 minute more.

  6. 6

    Slice each roll-up in half on the bias and serve over fresh arugula.

Tools you’ll need

  • cutting board
  • skillet (10-inch)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.