Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Ham & Cream Cheese Roll-Ups

Spread cream cheese on deli ham, wrap in tortilla, and crisp in a skillet until golden. Serve with fresh arugula for a quick, savory handheld that's ready in 10 minutes.

Total time
10 min
Servings
2
Calories
320
Protein
16g
Crispy Ham & Cream Cheese Roll-Ups
quicksimpleamericanporkcrispycreamyweeknightsandwich

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Lay 3 ham slices overlapping on a cutting board, then spread 1.5 oz cream cheese across them.

  2. Step 2

    Roll up tightly from one end, then place seam-side down on a tortilla and roll the tortilla around it.

  3. Step 3

    Repeat with remaining ham, cream cheese, and tortilla to make a second roll-up.

  4. Step 4

    Heat oil in a skillet over medium-high heat until shimmering, about 90 seconds.

  5. Step 5

    Place roll-ups seam-side down in the skillet and cook 2 minutes until golden, then flip and cook 1 minute more.

  6. Step 6

    Slice each roll-up in half on the bias and serve over fresh arugula.

Tools you’ll need

  • cutting board
  • skillet (10-inch)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.