Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Ham, Egg & Cheese Bagel

A toasted bagel loaded with crispy ham, melted cheddar, and a fried egg — breakfast that actually fills you up. Serve with refried beans and tortilla chips if you want a full plate.

Total time
12 min
Servings
1
Calories
390
Protein
24g
Crispy Ham, Egg & Cheese Bagel
satisfyingquickamericanegghamcrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Split the bagel in half and toast both halves cut-side up in a toaster oven until golden, about 3 minutes.

  2. Step 2

    Warm the ham in a skillet over medium heat for 1 minute, just until edges start to curl slightly.

  3. Step 3

    Crack the egg into the same skillet, season with salt and pepper, and fry until whites set but yolk still jiggles, about 3 minutes.

  4. Step 4

    Lay the cheddar slice on the warm bagel bottom, then stack the ham and fried egg on top.

  5. Step 5

    Top with the bagel upper half and serve immediately.

Tools you’ll need

  • toaster oven
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.