Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Herb Stuffed Peppers

Halved bell peppers stuffed with crispy breadcrumbs, feta, and herbs, then roasted until charred. A Mediterranean weeknight dinner that feels restaurant-worthy but takes 25 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
11g
Crispy Herb Stuffed Peppers
simpleelegantmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Place pepper halves on a sheet pan and drizzle with 1 tbsp olive oil, salt, and pepper.

  2. Step 2

    In a bowl, combine panko, feta, parsley, dill, lemon zest, and remaining 2 tbsp olive oil until breadcrumbs look moistened and clumpy.

  3. Step 3

    Divide cherry tomatoes among pepper halves, then top each with the breadcrumb mixture, pressing gently so it sticks.

  4. Step 4

    Roast for 15 minutes until pepper edges char and breadcrumb topping turns golden brown and crispy.

  5. Step 5

    Squeeze lemon juice over the top and serve hot straight from the pan.

Tools you’ll need

  • sheet pan
  • small bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.