Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Herb Stuffed Tomatoes

Hollow tomato halves stuffed with garlicky breadcrumbs, herbs, and feta, then roasted until the tops crisp up. A complete vegetarian dinner that feels fancy but takes 25 minutes.

Total time
25 min
Servings
4
Calories
318
Protein
11g
Crispy Herb Stuffed Tomatoes
freshrusticmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Slice tomatoes in half lengthwise and scoop out the seeds with a spoon, leaving a thin shell.

  2. Step 2

    Mix breadcrumbs, feta, parsley, dill, onion, lemon zest, juice, nuts, 3 tbsp olive oil, salt, and pepper in a bowl.

  3. Step 3

    Place tomato halves cut-side up on a sheet pan. Divide the filling evenly among them, packing gently.

  4. Step 4

    Drizzle the tops with a little more olive oil. Roast for 18–20 minutes until tomato flesh is tender and tops are golden.

  5. Step 5

    Serve hot or at room temperature, with a squeeze of fresh lemon if desired.

Tools you’ll need

  • sheet pan
  • spoon or melon baller
  • mixing bowl
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.