CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Hilopites with Brown Butter & Lemon

Homemade hand-torn egg pasta toasted until crackling, then tossed with nutty brown butter, fresh lemon, and tangy Kefalotyri. A rustic Greek dish that tastes like comfort and smells like a taverna.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Crispy Hilopites with Brown Butter & Lemon
rusticcomfortgreekvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1 cup all-purpose flour
  • 2 whole eggs
  • 4 tbsp butter
  • ½ cup Kefalotyri or Pecorino Romano cheese, grated
  • 1 whole lemon (zested + juiced)
  • 1 whole garlic clove, minced
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Make dough: mix flour, eggs, and a pinch of salt in a bowl until shaggy. Knead by hand 2 minutes until smooth.

  2. 2

    Tear dough into small, rough pieces (roughly pea to marble sized) and spread on a clean kitchen towel to dry, ~5 minutes.

  3. 3

    Heat butter in a large skillet over medium until it foams, then add minced garlic. Listen for sizzle; cook 30 seconds.

  4. 4

    Add hilopites pieces and toast, stirring often, until golden-brown and crispy throughout, ~6 minutes. Watch for fragrant, nutty aroma.

  5. 5

    Remove from heat. Toss with lemon juice, lemon zest, grated cheese, and parsley. Stir until the cheese melts slightly.

  6. 6

    Divide between bowls and serve immediately while crackling hot.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet (or larger)
  • wooden spoon
  • microplane or box grater
  • kitchen towel
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.