Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Hilopites with Brown Butter & Lemon

Homemade hand-torn egg pasta toasted until crackling, then tossed with nutty brown butter, fresh lemon, and tangy Kefalotyri. A rustic Greek dish that tastes like comfort and smells like a taverna.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Crispy Hilopites with Brown Butter & Lemon
rusticcomfortgreekvegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Make dough: mix flour, eggs, and a pinch of salt in a bowl until shaggy. Knead by hand 2 minutes until smooth.

  2. Step 2

    Tear dough into small, rough pieces (roughly pea to marble sized) and spread on a clean kitchen towel to dry, ~5 minutes.

  3. Step 3

    Heat butter in a large skillet over medium until it foams, then add minced garlic. Listen for sizzle; cook 30 seconds.

  4. Step 4

    Add hilopites pieces and toast, stirring often, until golden-brown and crispy throughout, ~6 minutes. Watch for fragrant, nutty aroma.

  5. Step 5

    Remove from heat. Toss with lemon juice, lemon zest, grated cheese, and parsley. Stir until the cheese melts slightly.

  6. Step 6

    Divide between bowls and serve immediately while crackling hot.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet (or larger)
  • wooden spoon
  • microplane or box grater
  • kitchen towel
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.