Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan-Fried Gnocchi with Sage & Parmesan

Pillowy gnocchi crisps up in a hot skillet with butter and sage, then finished with salty Parmesan. Golden and nutty in under 15 minutes—the weeknight pasta that feels fancy.

Total time
12 min
Servings
2
Calories
485
Protein
18g
Crispy Pan-Fried Gnocchi with Sage & Parmesan
comfortsimpleitalianvegetariancrispytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a 12-inch skillet over medium-high until foaming, ~90 seconds.

  2. Step 2

    Add half the gnocchi in a single layer without stirring; cook 3–4 minutes until golden brown underneath.

  3. Step 3

    Flip gnocchi and cook 2 minutes more until second side crisps, then transfer to a plate.

  4. Step 4

    Repeat with remaining 2 tbsp butter and gnocchi; return first batch to the skillet.

  5. Step 5

    Add sage leaves and cook 30 seconds until fragrant, then toss gnocchi gently to combine.

  6. Step 6

    Top with Parmesan and serve immediately while crispy.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.