Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Jalebi — Golden Fried Spirals

Tender, syrup-soaked fried spirals with a shatteringly crispy exterior and bright orange hue. A quick Indian sweet that's pure TikTok gold — watch the batter hit the oil and form those perfect loops.

Total time
25 min
Servings
2
Calories
385
Protein
3g
Crispy Jalebi — Golden Fried Spirals
indulgentcelebratoryindianvegetariancrispychewydessertweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, yogurt, turmeric, and orange coloring (if using) until you have a thin, smooth batter with no lumps.

  2. Step 2

    In a saucepan, combine 1 cup sugar with 1 cup water. Bring to a boil, then lower heat and simmer 5 minutes until syrupy.

  3. Step 3

    Heat 2 cups oil in a deep pan or wok to 350°F. Test by dropping a tiny batter dollop — it should sizzle and float immediately.

  4. Step 4

    Fill a piping bag with batter. Squeeze thin spiral coils directly into hot oil, creating connected loops about 3 inches wide.

  5. Step 5

    Fry 90 seconds per side until deep golden and crispy. Transfer to paper towels, then immediately dunk into warm syrup.

  6. Step 6

    Serve warm or at room temperature. The jalebi should be crispy outside, chewy and syrup-soaked inside.

Tools you’ll need

  • large deep pan or wok
  • candy thermometer
  • piping bag with medium round tip
  • paper towels
  • saucepan
  • whisk
  • slotted spoon or spider strainer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.