Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Crispy Jalebi Swirls

Golden, syrup-soaked spiral pastries made from a quick batter piped directly into hot oil, then dunked in warm saffron-orange syrup. Ready in minutes with zero fuss.

Total time
15 min
Servings
2
Calories
342
Protein
2g
15-Minute Crispy Jalebi Swirls
indulgentsimpleindianvegetariandairy-freecrispychewysnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine sugar, water, orange juice, saffron, and zest in a saucepan. Bring to a simmer over medium heat, stirring once, until syrup thickens slightly, ~3 minutes. Remove and let cool slightly.

  2. Step 2

    Whisk flour with 0.25 cup water and a pinch of salt until you have a smooth, pourable batter with the consistency of pancake batter.

  3. Step 3

    Heat 1.5 cups oil in a deep skillet over medium-high until a drop of batter sizzles immediately and rises, ~350°F (about 2 minutes).

  4. Step 4

    Transfer batter to a piping bag fitted with a small round tip. Carefully pipe 2–3 spiral swirls directly into the oil, one at a time.

  5. Step 5

    Fry swirls for 60–90 seconds until golden and crispy, then flip and cook another 60 seconds. Remove with a slotted spoon to a paper towel.

  6. Step 6

    Immediately dunk the warm jalebi into the cooled syrup, coating all sides. Lift out with a fork and place on a serving plate. Serve warm or at room temperature.

Tools you’ll need

  • medium saucepan
  • deep skillet or wok
  • piping bag with small round tip
  • slotted spoon
  • whisk
  • fork
  • paper towels
  • candy or deep-fry thermometer (optional but recommended)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.