Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Lahmacun with Yogurt & Lemon

Thin, crispy Turkish flatbread topped with spiced ground beef, finished with tangy yogurt sauce and fresh salad. A viral-worthy weeknight dinner that tastes like a Turkish restaurant—no yeast required.

Total time
20 min
Servings
2
Calories
520
Protein
24g
20-Min Crispy Lahmacun with Yogurt & Lemon
satisfyingcasualmiddle-easternbeefcrispytenderweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 tsp salt and 0.33 cup water until a soft dough forms, then knead 1 minute until smooth.

  2. Step 2

    Brown ground beef with minced onion in a skillet over medium-high heat, breaking up with a spoon, ~4 minutes.

  3. Step 3

    Stir in tomato paste, red pepper flakes, and a pinch of salt; cook 1 minute until fragrant.

  4. Step 4

    Divide dough into 2 balls. Flatten each on parchment into a thin 8-inch round, ~0.25 inches thick.

  5. Step 5

    Heat 1 tbsp oil in the same skillet over medium-high until shimmering, then pan-fry one flatbread 2 minutes per side until crispy and golden.

  6. Step 6

    Spread cooked beef topping on each crispy flatbread, top with a dollop of yogurt, a squeeze of lemon, and fresh salad.

Tools you’ll need

  • medium mixing bowl
  • 12-inch skillet
  • wooden spoon
  • parchment paper
  • lemon wedger or knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.