Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkish Lahmacun with Crispy Edges

Thin, blistered Turkish flatbread topped with spiced ground beef, finished with lemon and fresh salad. Ready in under 20 minutes with store-bought naan as the shortcut.

Total time
18 min
Servings
2
Calories
420
Protein
22g
Turkish Lahmacun with Crispy Edges
casualsatisfyingmiddle-easternbeefcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add ground beef and minced onion, breaking up the meat with a spoon until no pink remains, 4–5 minutes.

  3. Step 3

    Stir in tomato paste, cumin, and red pepper flakes. Cook until fragrant, 90 seconds.

  4. Step 4

    Warm naan directly over the stovetop flame or in a dry skillet until soft and pliable, 30 seconds per side.

  5. Step 5

    Spread beef mixture onto each piece of naan, leaving a 0.5-inch border. Sear in the skillet until edges crisp, 2 minutes per side.

  6. Step 6

    Serve with fresh salad, lemon wedges, and ayran (or yogurt-based drink) on the side.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.