Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Lemon Ravani Cake

Buttery Greek semolina cake soaked in bright lemon syrup and toasted coconut. Baked in one pan, crispy on edges, tender inside—ready in 20 minutes.

Total time
20 min
Servings
6
Calories
385
Protein
5g
Crispy Lemon Ravani Cake
simpleindulgentgreekvegetariancrispytendermoistDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 350°F. Mix melted butter, semolina, coconut, yogurt, sugar, and lemon zest in a bowl until evenly combined.

  2. Step 2

    Spread batter into a 9×9-inch baking pan, smooth the top, and cut into 9 squares. Place a whole almond or clove in the center of each.

  3. Step 3

    Bake until golden and edges pull slightly from the pan, 18-20 minutes. Cake should spring back when pressed lightly.

  4. Step 4

    While cake bakes, combine lemon juice and 0.75 cup sugar in a small pot and heat until sugar dissolves, ~2 minutes. Do not boil.

  5. Step 5

    Remove hot cake from oven and immediately pour warm lemon syrup over the top. Let it soak for 5 minutes before serving.

Tools you’ll need

  • 9x9-inch baking pan
  • mixing bowl
  • small pot
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.