Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Orange Semolina Cake with Crispy Edges

Greek ravani reimagined as a 25-minute sheet-pan cake: crispy-edged, tender crumb, soaked in an orange-honey syrup that makes it irresistible. One bowl, one pan, pure comfort.

Total time
25 min
Servings
6
Calories
385
Protein
7g
Orange Semolina Cake with Crispy Edges
cozysimplegreekvegetariancrispytendersoftDessert

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 350°F. Oil a 9x13 sheet pan generously.

  2. Step 2

    Whisk semolina, flour, coconut, and baking powder in a bowl until combined.

  3. Step 3

    Fold in yogurt and orange zest until a thick, shaggy batter forms.

  4. Step 4

    Spread batter evenly in the oiled pan. Smooth the top with a wet spatula.

  5. Step 5

    Bake until golden brown and a toothpick comes out clean, 18–20 minutes.

  6. Step 6

    While cake bakes, warm honey and orange juice in a saucepan over medium heat until steaming.

  7. Step 7

    Remove cake from oven. Pour warm syrup evenly over hot cake; let it soak 2 minutes.

  8. Step 8

    Cool 10 minutes in the pan, then cut into squares and serve warm or at room temperature.

Tools you’ll need

  • 9x13 sheet pan
  • medium bowl
  • whisk
  • wet spatula
  • oven thermometer (optional)
  • toothpick
  • saucepan
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.