Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Lime Shrimp Tostadas

Golden tostadas topped with bright ceviche-style shrimp, creamy avocado, and a zesty lime punch. Ready in under 15 minutes — crispy, tangy, and totally craveable.

Total time
12 min
Servings
2
Calories
285
Protein
18g
Crispy Lime Shrimp Tostadas
freshlightcalifornianshrimpcrispycreamyweeknightappetizer

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a skillet over medium-high until it shimmers. Fry each tortilla 60–90 seconds per side until golden and crispy.

  2. Step 2

    While tortillas cool, toss shrimp with diced red onion, cilantro, juice of 1 lime, salt, and pepper.

  3. Step 3

    Halve and pit the avocado, then slice each half into thin wedges.

  4. Step 4

    Top each crispy tortilla with avocado slices, then pile the shrimp mixture on top.

  5. Step 5

    Squeeze the remaining lime over everything. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • tongs or fork
  • small bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.