Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mackerel Sushi Press

Hot-seared mackerel pressed into seasoned sushi rice with crispy edges, topped with pickled ginger and wasabi. A 20-minute viral sushi bowl that skips the rolling.

Total time
20 min
Servings
2
Calories
480
Protein
38g
Crispy Mackerel Sushi Press
elegantfreshjapanesemackerelcrispytendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Warm cooked rice with rice vinegar and sugar until grains just stick together but remain loose. Divide between two bowls.

  2. Step 2

    Pat mackerel fillets dry and season both sides generously with salt and black pepper.

  3. Step 3

    Heat oil in a skillet over medium-high until shimmering. Sear mackerel skin-side down 2 minutes until skin crisps and releases easily.

  4. Step 4

    Flip and sear flesh side 90 seconds until opaque. Transfer to a cutting board and slice into bite-sized pieces.

  5. Step 5

    Arrange mackerel pieces in a single layer over each rice bowl, pressing gently so they adhere to the warm rice.

  6. Step 6

    Top each bowl with pickled ginger, a dollop of wasabi, nori strips, and sesame seeds. Serve immediately.

Tools you’ll need

  • two serving bowls
  • 12-inch non-stick skillet
  • paper towels
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.