Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Malakoff Cheese Ball with Cherry Tomatoes

Swiss fried cheese ball with melted gruyère and emmental inside, a golden-brown exterior, and fresh cherry tomatoes on the side. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Crispy Malakoff Cheese Ball with Cherry Tomatoes
indulgentcomfortswissvegetariancheesecrispymeltycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix shredded gruyère and emmental in a bowl with a pinch of salt and pepper until combined.

  2. Step 2

    Roll cheese mixture into a tight ball the size of a small grapefruit, then freeze for 5 minutes.

  3. Step 3

    Set up three shallow bowls: one with flour, one with beaten eggs, one with panko mixed with a pinch of salt.

  4. Step 4

    Coat cheese ball in flour, shaking off excess, then dip in egg, then roll in panko until fully crusted.

  5. Step 5

    Heat oil in a deep skillet over medium-high to 350°F, then carefully slide in cheese ball. Fry 3–4 minutes, turning gently once, until deep golden brown.

  6. Step 6

    Transfer to a plate lined with paper towels. Serve hot alongside cherry tomatoes and shredded cheese.

Tools you’ll need

  • mixing bowl
  • spoon
  • three shallow bowls
  • deep skillet or saucepan
  • instant-read or candy thermometer
  • slotted spoon or spider strainer
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.