CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Malakoff Cheese Ball with Cherry Tomatoes

Swiss fried cheese ball with melted gruyère and emmental inside, a golden-brown exterior, and fresh cherry tomatoes on the side. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Crispy Malakoff Cheese Ball with Cherry Tomatoes
indulgentcomfortswissvegetariancheesecrispymeltycreamy

Ingredients

  • 1 cup gruyère cheese, shredded
  • ¾ cup emmental cheese, shredded
  • ½ cup all-purpose flour
  • 2 whole eggs
  • 1 cup panko breadcrumbs
  • 1 cup cherry tomatoes

Instructions

  1. 1

    Mix shredded gruyère and emmental in a bowl with a pinch of salt and pepper until combined.

  2. 2

    Roll cheese mixture into a tight ball the size of a small grapefruit, then freeze for 5 minutes.

  3. 3

    Set up three shallow bowls: one with flour, one with beaten eggs, one with panko mixed with a pinch of salt.

  4. 4

    Coat cheese ball in flour, shaking off excess, then dip in egg, then roll in panko until fully crusted.

  5. 5

    Heat oil in a deep skillet over medium-high to 350°F, then carefully slide in cheese ball. Fry 3–4 minutes, turning gently once, until deep golden brown.

  6. 6

    Transfer to a plate lined with paper towels. Serve hot alongside cherry tomatoes and shredded cheese.

Tools you’ll need

  • mixing bowl
  • spoon
  • three shallow bowls
  • deep skillet or saucepan
  • instant-read or candy thermometer
  • slotted spoon or spider strainer
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.