Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Malakoff: Cheese & Ham Stack

A Swiss classic reimagined as a golden, melty-cheese-and-ham stack that crisps in one skillet. Tender inside, crunchy outside, ready in 15 minutes.

Total time
15 min
Servings
2
Calories
428
Protein
18g
Crispy Malakoff: Cheese & Ham Stack
comfortindulgentswissvegetariancheesecrispymeltycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange 3 cheese slices overlapping on a board; spread with half the mustard, then top with 3 more cheese slices.

  2. Step 2

    Place flour in one shallow bowl, beaten egg in another, breadcrumbs in a third.

  3. Step 3

    Dredge the cheese stack in flour, shaking off excess; dip in egg until coated, then press into breadcrumbs on both sides.

  4. Step 4

    Heat butter in a skillet over medium-high until foaming, about 90 seconds.

  5. Step 5

    Slide the breaded stack into the skillet; fry until golden and cheese begins peeking through edges, 2 to 3 minutes per side.

  6. Step 6

    Transfer to a plate, let rest 1 minute, slice in half, and serve immediately with a small salad or cornichons.

Tools you’ll need

  • cutting board
  • 12-inch nonstick or cast iron skillet
  • three shallow bowls
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.