Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Msemen with Honey & Butter

Laminated Moroccan flatbread with a flaky, crispy exterior and tender layers inside. Serve warm with honey, a drizzle of melted butter, and a steaming cup of tea for an authentic breakfast that feels fancy but takes under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
6g
Crispy Msemen with Honey & Butter
cozyindulgentmoroccanvegetariancrispyflakytenderbreakfast

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, salt, and 1 tbsp butter with warm water until a soft dough forms, ~2 minutes.

  2. Step 2

    Divide dough into 2 balls. Stretch each into a thin 8-inch square on a work surface.

  3. Step 3

    Brush one square with melted butter, fold in half, brush again, fold in half again to form a small square.

  4. Step 4

    Repeat with the second square. Let both rest 2 minutes while you heat a skillet.

  5. Step 5

    Heat 1 tbsp butter in a skillet over medium-high until it foams, ~90 seconds.

  6. Step 6

    Pan-fry each msemen square 3–4 minutes per side until golden brown and crispy, working in batches.

  7. Step 7

    Transfer to a plate, drizzle with honey, sprinkle with sesame seeds, and serve warm.

Tools you’ll need

  • medium mixing bowl
  • 12-inch skillet or griddle
  • spatula
  • work surface
  • kitchen timer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.