Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sweet Butter Msemen

Crispy pan-fried Moroccan layered pastry with melted butter and cinnamon sugar. Ready in 15 minutes — no phyllo or lamination needed, just a skillet and a simple dough.

Total time
15 min
Servings
2
Calories
520
Protein
6g
Sweet Butter Msemen
comfortcozymoroccanvegetarianvegetariancrispyflakymelty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, salt, and 2 tbsp melted butter in a bowl with warm water until a rough dough forms.

  2. Step 2

    Knead dough on a floured surface for 2 minutes until smooth, then divide into 2 balls.

  3. Step 3

    Roll one ball into a thin 8-inch square, brush with melted butter, fold in half, brush again, fold in half again to make a small square.

  4. Step 4

    Heat 2 tbsp butter in a 10-inch skillet over medium until it foams, then slide one folded pastry square in.

  5. Step 5

    Cook 3 minutes until bottom is golden, flip once, cook 2 more minutes until second side is golden and crispy.

  6. Step 6

    Mix cinnamon and sugar on a plate, press warm msemen into the mixture to coat both sides, then repeat with second square. Serve warm.

Tools you’ll need

  • mixing bowl
  • 10-inch skillet
  • spatula
  • rolling pin

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.