Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Banh Pia — Vietnamese Mung Bean Pastries

Flaky, buttery pastry pockets with a sweet mung bean and sesame filling. Hand-formed in under 25 minutes and finished golden in a skillet for that viral crackle.

Total time
25 min
Servings
4
Calories
385
Protein
7g
Crispy Banh Pia — Vietnamese Mung Bean Pastries
casualindulgentvietnamesevegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, butter, egg yolk, and a pinch of salt in a bowl with your fingers until the mixture looks like breadcrumbs. Add 2 tbsp cold water and press until a shaggy dough forms.

  2. Step 2

    Fold mung bean paste with sesame seeds, sugar, and vanilla. Divide into 8 portions and roll into balls.

  3. Step 3

    Pinch off 1 tbsp dough, flatten to a disk, place one filling ball in center, wrap dough around it, and seal by pressing and shaping into a 2-inch round disk.

  4. Step 4

    Heat oil in a 12-inch skillet over medium until shimmering. Pan-fry pastries 2 minutes per side until golden-brown edges curl slightly.

  5. Step 5

    Serve warm. The exterior should crackle when you bite; mung bean center stays creamy.

Tools you’ll need

  • medium mixing bowl
  • 12-inch non-stick or cast-iron skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.