Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan-Fried Cornbread

Golden, crunchy cornbread squares fried until the edges curl and the inside stays tender. Ready in 15 minutes with a skillet and basic pantry staples.

Total time
15 min
Servings
4
Calories
320
Protein
4g
Crispy Pan-Fried Cornbread
comfortcasualsouthernvegetariancrispytenderweeknightcomfort-food-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the cornbread into 2-inch squares. Pat each piece dry with a paper towel.

  2. Step 2

    Heat butter and oil in a 12-inch skillet over medium-high heat until the surface shimmers, about 90 seconds.

  3. Step 3

    Working in batches, add cornbread squares to the hot pan without crowding. Cook until deep golden, 2–3 minutes per side.

  4. Step 4

    Transfer fried cornbread to a paper towel–lined plate. Season immediately with salt and pepper.

  5. Step 5

    Scatter fresh chives over the top if desired. Serve warm.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • tongs or slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.