Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan-Fried Dumplings

Frozen soup dumplings get golden and crispy in a hot skillet with minimal oil, then served with a simple soy dipping sauce. Ready in 12 minutes—the ultimate lazy dinner.

Total time
12 min
Servings
2
Calories
285
Protein
8g
Crispy Pan-Fried Dumplings
quicksatisfyingchinesecrispychewyweeknightappetizerdinner

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 10-inch nonstick skillet over medium-high heat until shimmering, about 90 seconds.

  2. Step 2

    Arrange dumplings flat-side down in the skillet without crowding—work in batches if needed.

  3. Step 3

    Cook undisturbed for 4 minutes until the bottoms turn golden brown and crispy.

  4. Step 4

    Flip each dumpling and cook the second side for 2 minutes until golden.

  5. Step 5

    Pour soy sauce into a small bowl for dipping.

  6. Step 6

    Transfer dumplings to a plate and serve hot with soy sauce on the side.

Tools you’ll need

  • 10-inch nonstick skillet
  • spatula
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.