Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Parmesan Zucchini Fries

Thin zucchini strips coated in crispy breadcrumbs and parmesan, baked until golden in under 20 minutes. Serve with a simple dipping sauce and a tangy slaw for a complete weeknight dinner.

Total time
20 min
Servings
2
Calories
145
Protein
8g
Crispy Parmesan Zucchini Fries
casualcomfortamericanvegetariancrispytenderweeknightside

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F and line a sheet pan with parchment paper.

  2. Step 2

    Slice zucchini lengthwise into 1/4-inch-thick planks, then cut into 1/4-inch sticks.

  3. Step 3

    Whisk egg in a shallow bowl, then combine breadcrumbs and parmesan in another bowl.

  4. Step 4

    Dip each zucchini stick in egg, then dredge in breadcrumb mixture, pressing gently to coat.

  5. Step 5

    Arrange coated fries on sheet pan in a single layer, spray lightly with cooking oil.

  6. Step 6

    Bake 15–18 minutes until edges are golden and crispy, shaking pan halfway through.

Tools you’ll need

  • sheet pan
  • parchment paper
  • sharp knife
  • two shallow bowls
  • cooking spray

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.