CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Crispy Pempek with Cuko Sauce

Indonesian fish cakes (pempek) fried until golden and served with tangy-savory cuko sauce. A weeknight version using store-bought fish cake or ground fish, ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
16g
25-Min Crispy Pempek with Cuko Sauce
casualcomfortindonesianfishcrispychewyweeknightdinner

Ingredients

  • 8 oz ground fish or store-bought fish cake, sliced into 1-inch rounds
  • ¼ cup all-purpose flour
  • 3 tbsp neutral cooking oil, for frying
  • 3 tbsp white vinegar
  • 1 tbsp brown sugar
  • 2 clove garlic cloves, minced
  • ½ whole red chili, sliced thin (or chili flakes to taste)

Instructions

  1. 1

    Make the sauce: combine vinegar, sugar, minced garlic, and sliced chili in a small bowl. Stir until sugar dissolves, ~2 minutes. Set aside.

  2. 2

    Pat the fish cake slices dry with a paper towel. Dust both sides lightly with flour, shaking off excess.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  4. 4

    Working in batches, fry pempek 2-3 minutes per side until golden and crispy. Transfer to a paper towel.

  5. 5

    Arrange warm pempek on a plate and pour cuko sauce into a small bowl alongside for dipping.

Tools you’ll need

  • large skillet
  • small bowl
  • paper towels
  • shallow plate or dish for flour

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.