Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Crispy Pempek with Cuko Sauce

Indonesian fish cakes (pempek) fried until golden and served with tangy-savory cuko sauce. A weeknight version using store-bought fish cake or ground fish, ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
16g
25-Min Crispy Pempek with Cuko Sauce
casualcomfortindonesianfishcrispychewyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Make the sauce: combine vinegar, sugar, minced garlic, and sliced chili in a small bowl. Stir until sugar dissolves, ~2 minutes. Set aside.

  2. Step 2

    Pat the fish cake slices dry with a paper towel. Dust both sides lightly with flour, shaking off excess.

  3. Step 3

    Heat oil in a large skillet over medium-high until it shimmers, ~90 seconds.

  4. Step 4

    Working in batches, fry pempek 2-3 minutes per side until golden and crispy. Transfer to a paper towel.

  5. Step 5

    Arrange warm pempek on a plate and pour cuko sauce into a small bowl alongside for dipping.

Tools you’ll need

  • large skillet
  • small bowl
  • paper towels
  • shallow plate or dish for flour

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.