Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fish Pempek with Spicy Vinegar Sauce

Indonesian fried fish cakes with tapioca shell and tangy spiced vinegar dip. Ready in 25 minutes with crispy edges and a tender, savory center.

Total time
25 min
Servings
2
Calories
520
Protein
24g
Crispy Fish Pempek with Spicy Vinegar Sauce
casualsatisfyingindonesianfishcrispytenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse fish in a food processor until finely ground, ~30 seconds. Transfer to a bowl.

  2. Step 2

    Mix tapioca flour, all-purpose flour, fish sauce, and 0.25 cup water into the ground fish until a paste forms.

  3. Step 3

    Heat oil in a deep skillet over medium-high until it shimmers, ~90 seconds.

  4. Step 4

    Scoop tablespoon-sized portions of paste and drop into hot oil. Fry until golden brown and crispy, ~4 minutes per batch.

  5. Step 5

    Whisk vinegar, chili paste, shrimp paste if using, 0.25 cup water, and a pinch of salt until smooth.

  6. Step 6

    Drain pempek on paper towels. Serve immediately with spiced vinegar sauce for dipping.

Tools you’ll need

  • food processor
  • bowl
  • deep skillet or sauce pot (3-quart minimum)
  • slotted spoon or spider strainer
  • paper towels
  • small bowl or serving cup for sauce

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.