Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Perkedel with Rice, Greens & Sambal

Golden-fried Indonesian potato fritters served with steamed rice, fresh green beans, and bright tomato sambal. A complete weeknight dinner that comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
9g
Crispy Perkedel with Rice, Greens & Sambal
comfortcasualindonesianvegetarianvegetariancrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until fork-tender, about 10 minutes. Drain and mash while still warm.

  2. Step 2

    Fold green onions and flour into mashed potatoes. Season with salt and pepper. Let cool 2 minutes, then shape into 8–10 oval patties.

  3. Step 3

    Heat 0.25 inch oil in a large skillet over medium-high until shimmering. Fry perkedel in batches until golden-brown on both sides, about 3 minutes total.

  4. Step 4

    While perkedel cooks, boil rice in salted water according to package directions (typically 12–15 minutes). Drain and keep warm.

  5. Step 5

    Steam green beans in a separate pot or microwave 4–5 minutes until tender-crisp. Season with salt and pepper.

  6. Step 6

    Divide rice, green beans, and perkedel among plates. Serve with tomato sambal on the side.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • medium pot or microwave-safe bowl
  • fork or potato masher
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.