Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Krokiety with Sour Cream

Polish fried crepe rolls stuffed with seasoned mashed potato—golden, crispy outside, creamy inside. Serve with a dollop of sour cream for the classic combination.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Crispy Potato Krokiety with Sour Cream
comfortcasualpolishvegetarianvegetariancrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until fork-tender, about 8 minutes. Drain well and return to pot.

  2. Step 2

    Mash potatoes with butter and a pinch of salt and pepper until smooth. Set aside to cool slightly.

  3. Step 3

    Whisk flour, milk, eggs, and a pinch of salt into a thin batter—like crêpe batter, no lumps.

  4. Step 4

    Heat 1 tbsp oil in a 10-inch skillet over medium-high. Pour 2 tbsp batter, tilt to coat thinly, cook until light gold, ~60 seconds per side. Stack finished crêpes.

  5. Step 5

    Spread 1 tbsp warm mashed potato on the center third of each crêpe. Fold in sides, then roll tightly into a cylinder.

  6. Step 6

    Heat remaining oil in the same skillet to 350°F. Fry krokiety in batches, seam-side down first, until deep golden, ~90 seconds per side. Drain on paper towels.

  7. Step 7

    Serve hot with a dollop of sour cream on the side.

Tools you’ll need

  • medium pot
  • 10-inch nonstick skillet
  • whisk
  • spatula
  • paper towels
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.