Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pierogi with Caramelized Onions

Frozen pierogi crisped in a skillet with deeply golden caramelized onions, sour cream, and fresh dill. No dough-making required—just pan-fry and top.

Total time
20 min
Servings
4
Calories
385
Protein
11g
Crispy Pierogi with Caramelized Onions
comfortrusticpolishvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice onions into thin half-moons. Heat 1 tbsp butter in a large skillet over medium.

  2. Step 2

    Add onions with a pinch of salt. Cook, stirring often, until deep golden, ~10 minutes.

  3. Step 3

    Push onions to the side. Add remaining 2 tbsp butter, then slide in pierogi in a single layer.

  4. Step 4

    Sear pierogi without moving for 3 minutes per side until golden and crispy at edges.

  5. Step 5

    Toss pierogi with onions. Sprinkle paprika, then stir in dill and a pinch of black pepper.

  6. Step 6

    Transfer to a plate and serve hot with sour cream on the side or dolloped on top.

Tools you’ll need

  • 12-inch skillet
  • knife and cutting board
  • wooden spoon
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.