Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheese Dakgalbi

Spicy stir-fried chicken with sweet rice cakes, melted cheese, and gochujang sauce. A Korean comfort dish that's crispy, cheesy, and deeply satisfying in one pan.

Total time
40 min
Servings
4
Calories
520
Protein
38g
Cheese Dakgalbi
comfortindulgentkoreanchickencrispytendermeltychewy

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk gochujang, honey, soy sauce, vinegar, and garlic in a bowl until smooth and no lumps remain.

  2. Step 2

    Pat chicken dry with paper towels and season generously with salt and pepper.

  3. Step 3

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 60 seconds.

  4. Step 4

    Add chicken and cook, stirring frequently, until browned on all sides and no pink remains, 8–10 minutes.

  5. Step 5

    Pour sauce into the skillet and stir to coat all chicken pieces evenly.

  6. Step 6

    Add rice cakes and stir gently until coated in sauce and warmed through, 3–4 minutes.

  7. Step 7

    Scatter cheese cubes over the top and cook without stirring until cheese begins to melt, 2–3 minutes.

  8. Step 8

    Stir gently to combine melted cheese with chicken and rice cakes.

  9. Step 9

    Garnish with scallions and serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet or large wok
  • mixing bowl
  • whisk
  • paper towels
  • wooden spoon or silicone spatula
  • chef's knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.