Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pita Fattoush with Sumac Dressing

Tangy, crunchy Lebanese salad loaded with fresh greens, tomatoes, and crispy pita chips, all tossed with a bright lemon-sumac vinaigrette. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
320
Protein
8g
Crispy Pita Fattoush with Sumac Dressing
lightfreshmiddle-easternvegetarianvegancrispycrunchyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Tear pita into bite-sized pieces. Spread on a baking sheet and toast under a broiler or in a 400°F oven for 2 minutes per side until golden and crispy.

  2. Step 2

    While pita toasts, chop romaine, tomatoes, cucumber, and radishes into a large bowl.

  3. Step 3

    Whisk lemon juice with 3 tablespoons olive oil, 1 tablespoon sumac, and a pinch of salt and pepper.

  4. Step 4

    Toss the greens and vegetables with the dressing until everything is coated.

  5. Step 5

    Add warm pita chips and toss gently to combine. Serve immediately while pita is still crispy.

Tools you’ll need

  • baking sheet
  • broiler or oven
  • large mixing bowl
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.