Back to recipes
Crispy Pita Pizzas
Pita bread topped with pizza sauce, melted mozzarella, and spinach, then baked until the cheese bubbles. Ready in 12 minutes — the weeknight pizza that actually happens.
- Total time
- 12 min
- Servings
- 2
- Calories
- 320
- Protein
- 14g
quickcasualitalianvegetariancrispymeltyweeknightpizza
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 400°F.
Step 2
Spread 2 pita rounds on a sheet pan, then divide pizza sauce evenly between them.
Step 3
Layer spinach onto each pita, dividing evenly, then top with shredded mozzarella.
Step 4
Bake until cheese melts and edges bubble, about 8 minutes.
Step 5
Serve hot.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
